PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00533.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 314aa    MW: 34688.1 Da    PI: 9.7197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00533.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.9e-092974347
                                  SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                                   WT+ E + + +a + l  +  +W+++a+ ++ gRt  +++s+++++
  Zmw_sc00533.1.g00320.1.am.mk 29 VWTAKENKEFERALAALDLRrpDWEKVAQAIP-GRTVDEVVSHFRSL 74
                                  6*****************99************.***********975 PP

2Myb_DNA-binding452.5e-14146190347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +WT+eE+ l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Zmw_sc00533.1.g00320.1.am.mk 146 PWTEEEHRLFLLGLKKYGKGDWRNISRNFVHTRTPTQVASHAQKY 190
                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.2112579IPR017884SANT domain
SMARTSM007171.9E-42677IPR001005SANT/Myb domain
PfamPF002495.8E-72974IPR001005SANT/Myb domain
CDDcd001671.47E-63074No hitNo description
SuperFamilySSF466892.58E-83082IPR009057Homeodomain-like
PROSITE profilePS5129419.53139195IPR017930Myb domain
SuperFamilySSF466896.95E-18140195IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-17142193IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-12143189IPR009057Homeodomain-like
SMARTSM007172.9E-13143193IPR001005SANT/Myb domain
PfamPF002493.3E-12146190IPR001005SANT/Myb domain
CDDcd001671.88E-11146191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMREAYMEVL PPMDHYTSRS NWFLGAPRVW TAKENKEFER ALAALDLRRP DWEKVAQAIP  60
GRTVDEVVSH FRSLEVDVRQ IESGVMPFPG YGGGRGGAAN SFTLQWDGSS GHVAGDFRHG  120
GYRFAGGCGK RHPGRTPEQE RKKGVPWTEE EHRLFLLGLK KYGKGDWRNI SRNFVHTRTP  180
TQVASHAQKY FIRLNSGGKD KRRSSIHDIT TVNLNDDQPP SPTQSSLITK QSNALAPTAA  240
VSQFSLKGDT KQHGSANLPF NSPSRTPGGM PAYGMGLQDQ GLQCAPLHDQ LLPDDGIGSQ  300
MSAALPLFCF PFAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-152591673RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.11e-166PREDICTED: transcription factor DIVARICATA
TrEMBLA5HJS51e-174A5HJS5_9POAL; MYB_Al protein
STRINGSi002426m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348